PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_007649-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family WRKY
Protein Properties Length: 303aa    MW: 33661.7 Da    PI: 6.6236
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_007649-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.91.8e-32116172258
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                    dDgy+WrKYGqK++k++++prsYYrCt ++C++kk+vers++dp++++itYeg H h
  NNU_007649-RA 116 DDGYKWRKYGQKSIKNNPNPRSYYRCTNPRCSAKKQVERSSSDPETLVITYEGLHLH 172
                    8******************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.4E-30109172IPR003657WRKY domain
PROSITE profilePS5081128.621110175IPR003657WRKY domain
SuperFamilySSF1182901.18E-26113172IPR003657WRKY domain
SMARTSM007742.3E-36115174IPR003657WRKY domain
PfamPF031067.2E-26116172IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MERLMQLTAN LSNGSEDELV RELLDNESPF LVLPETIEPK PCLSPEPLIN RLISAAYSGP  60
TIEDIESALS TTNRNNESDD HRSMSQARIS ILEKGLSKID NKYTMKVKST GNGLADDGYK  120
WRKYGQKSIK NNPNPRSYYR CTNPRCSAKK QVERSSSDPE TLVITYEGLH LHFAYSHFLP  180
SPSYQAHLAV KKPKKDILQV PDQPTQHALQ VQTHECSPTP GPTPPSPFSS SDQQQEELVK  240
GEADRQGLLE DMVPLMIRNP CNKNALSTSS CYPSSPLSSS SSTLSWSPNY SSFVDAGIIS  300
SMR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A1e-211141721674Probable WRKY transcription factor 4
1wj2_A1e-211141721674Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010256886.10.0PREDICTED: probable WRKY transcription factor 49
TrEMBLD7THM01e-95D7THM0_VITVI; Putative uncharacterized protein
STRINGVIT_08s0007g00570.t013e-95(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43290.11e-47WRKY DNA-binding protein 49